{"product_id":"proteintech-84314-2-rr","title":"Proteintech, 84314-2-RR, ALKBH3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ALKBH3 (84314-2-RR) by Proteintech is a Recombinant antibody targeting ALKBH3 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84314-2-RR targets ALKBH3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, mouse kidney tissue,  SGC-7901 cells,  mouse heart tissue,  rat heart tissue\nPositive FC (Intra) detected in: PC-3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This antibody specifically recognizes isoform 1 as 33kDa (Uniprot). It is possible that there is ubiquitination modification (PMID: 25944111).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species\nFull Name: alkB, alkylation repair homolog 3 (E. coli)\nCalculated Molecular Weight: 286 aa, 33 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC015155\nGene Symbol: ALKBH3\nGene ID (NCBI): 221120\nRRID: AB_3671855\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96Q83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888691826857,"sku":"84314-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84314-2-rr","provider":"Iright","version":"1.0","type":"link"}