{"product_id":"proteintech-84332-5-rr","title":"Proteintech, 84332-5-RR, UTY Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe UTY (84332-5-RR) by Proteintech is a Recombinant antibody targeting UTY in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84332-5-RR targets UTY in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IF\/ICC detected in: MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUTY (Ubiquitously Transcribed Tetratricopeptide Repeat Containing, Y-Linked) is a protein-coding gene located on the Y chromosome. It is the Y-linked homolog of the X-linked gene KDM6A, which encodes a histone demethylase. UTY is involved in the regulation of gene expression and chromatin structure, similar to its X-linked counterpart KDM6A (PMID: 31097364). UTY is expressed in various tissues and is predicted to be involved in transcription, translation, and nucleic acid binding, which are central to the regulation of gene expression during development, immune function, cell proliferation, and differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35806 Product name: Recombinant human UTY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-655 aa of NM_007125.4 Sequence: QQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATS Predict reactive species\nFull Name: ubiquitously transcribed tetratricopeptide repeat gene, Y-linked\nCalculated Molecular Weight: 150kDa，1347aa\nObserved Molecular Weight: 130-160kDa\nGenBank Accession Number: NM_007125.4\nGene Symbol: UTY\nGene ID (NCBI): 7404\nRRID: AB_3671873\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O14607\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888674099369,"sku":"84332-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84332-5-rr","provider":"Iright","version":"1.0","type":"link"}