{"product_id":"proteintech-84340-2-rr","title":"Proteintech, 84340-2-RR, ORAI3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ORAI3 (84340-2-RR) by Proteintech is a Recombinant antibody targeting ORAI3 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84340-2-RR targets ORAI3 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  A549 cells\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag36135 Product name: Recombinant human ORAI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species\nFull Name: ORAI calcium release-activated calcium modulator 3\nCalculated Molecular Weight: 295 aa, 32 kDa\nObserved Molecular Weight: ~30 kDa，~60 kDa\nGenBank Accession Number: BC006126\nGene Symbol: ORAI3\nGene ID (NCBI): 93129\nRRID: AB_3671881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BRQ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888438038697,"sku":"84340-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84340-2-rr","provider":"Iright","version":"1.0","type":"link"}