{"product_id":"proteintech-84372-4-rr","title":"Proteintech, 84372-4-RR, IKKA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IKKA (84372-4-RR) by Proteintech is a Recombinant antibody targeting IKKA in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84372-4-RR targets IKKA in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Daudi cells,  HeLa cells,  HepG2 cells,  RAW 264.7 cells,  C6 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species\nFull Name: conserved helix-loop-helix ubiquitous kinase\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: NM_001278\nGene Symbol: IKK Alpha\nGene ID (NCBI): 1147\nRRID: AB_3671907\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O15111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888766832809,"sku":"84372-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84372-4-rr","provider":"Iright","version":"1.0","type":"link"}