{"product_id":"proteintech-84398-3-rr","title":"Proteintech, 84398-3-RR, MACROD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MACROD1 (84398-3-RR) by Proteintech is a Recombinant antibody targeting MACROD1 in WB, ELISA applications with reactivity to human samples\n84398-3-RR targets MACROD1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293 cells,  HeLa cells,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMACRO domain containing 1 (Macrod1) is also named as LRP16. Macrod1 is an ADP-ribosylhydrolase 1 that is highly enriched in mitochondria, participating in the pathogenesis of cardiovascular diseases (PMID: 38459256). MacroD1 was recruited to the sites of DNA damage via recognition of ADP-ribosylation at DNA lesions (PMID: 32683309). MacroD1 is highly expressed in human and mouse skeletal muscle (PMID: 29410655). Macrod1 may play an important role in carcinogenesis and\/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation (PMID: 17893710, PMID: 17914104). Macrod1 could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells (PMID: 17893710).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34080 Product name: Recombinant human MACROD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-166 aa of BC008316 Sequence: AMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV Predict reactive species\nFull Name: MACRO domain containing 1\nCalculated Molecular Weight: 325 aa, 36 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC008316\nGene Symbol: MACROD1\nGene ID (NCBI): 28992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BQ69\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888779153577,"sku":"84398-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84398-3-rr","provider":"Iright","version":"1.0","type":"link"}