{"product_id":"proteintech-84401-4-rr","title":"Proteintech, 84401-4-RR, NeuN Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NeuN (84401-4-RR) by Proteintech is a Recombinant antibody targeting NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig samples\n84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, pig brain tissue,  rat cerebellum tissue,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue, mouse cerebellum tissue,  mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:3000-1:12000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species\nFull Name: hexaribonucleotide binding protein 3\nObserved Molecular Weight: 46-52 kDa\nGenBank Accession Number: NM_001082575\nGene Symbol: NeuN\nGene ID (NCBI): 146713\nRRID: AB_3671930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: A6NFN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888869462185,"sku":"84401-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84401-4-rr","provider":"Iright","version":"1.0","type":"link"}