{"product_id":"proteintech-84494-2-rr","title":"Proteintech, 84494-2-RR, EPCR\/CD201 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPCR\/CD201 (84494-2-RR) by Proteintech is a Recombinant antibody targeting EPCR\/CD201 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to mouse samples\n84494-2-RR targets EPCR\/CD201 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse placenta tissue\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse placenta tissue\nPositive IF\/ICC detected in: bEnd.3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein C receptor (PROCR), also known as activated protein C receptor (APC receptor), EPCR, or CD201, is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective impact on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1517 Product name: Recombinant Mouse EPCR\/CD201 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-214 aa of NM_011171.2 Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS Predict reactive species\nFull Name: protein C receptor, endothelial\nCalculated Molecular Weight: 27kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: NM_011171.2\nGene Symbol: PROCR\nGene ID (NCBI): 19124\nRRID: AB_3672007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q64695\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888425652393,"sku":"84494-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84494-2-rr","provider":"Iright","version":"1.0","type":"link"}