{"product_id":"proteintech-84497-4-rr","title":"Proteintech, 84497-4-RR, GLAST\/EAAT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GLAST\/EAAT1 (84497-4-RR) by Proteintech is a Recombinant antibody targeting GLAST\/EAAT1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84497-4-RR targets GLAST\/EAAT1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: Neuro-2a cells\nPositive FC (Intra) detected in: HEK-293 cells, U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression\/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16962 Product name: Recombinant human SLC1A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 471-542 aa of BC037310 Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM Predict reactive species\nFull Name: solute carrier family 1 (glial high affinity glutamate transporter), member 3\nCalculated Molecular Weight: 542 aa, 60 kDa\nGenBank Accession Number: BC037310\nGene Symbol: GLAST\nGene ID (NCBI): 6507\nRRID: AB_3672010\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P43003\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888755789993,"sku":"84497-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84497-4-rr","provider":"Iright","version":"1.0","type":"link"}