{"product_id":"proteintech-84511-5-rr","title":"Proteintech, 84511-5-RR, MCM2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MCM2 (84511-5-RR) by Proteintech is a Recombinant antibody targeting MCM2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84511-5-RR targets MCM2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells,  Jurkat cells,  NIH\/3T3 cells,  HSC-T6 cells,  A431 cells\nPositive IHC detected in: human tonsillitis tissue, human cervical squamous cancer tissue,  human colon cancer tissue,  human placenta tissue,  human skin tissue,  mouse colon tissue,  mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0798 Product name: Recombinant human MCM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 657-904 aa of BC007670 Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF Predict reactive species\nFull Name: minichromosome maintenance complex component 2\nCalculated Molecular Weight: 102 kDa\nObserved Molecular Weight: 116-125 kDa\nGenBank Accession Number: BC007670\nGene Symbol: MCM2\nGene ID (NCBI): 4171\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P49736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888781447337,"sku":"84511-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84511-5-rr","provider":"Iright","version":"1.0","type":"link"}