{"product_id":"proteintech-84558-1-rr","title":"Proteintech, 84558-1-RR, Integrin beta-8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Integrin beta-8 (84558-1-RR) by Proteintech is a Recombinant antibody targeting Integrin beta-8 in WB, ELISA applications with reactivity to human samples\n84558-1-RR targets Integrin beta-8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:9000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1\/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95-100 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31161 Product name: Recombinant human Integrin beta-8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 460-620 aa of NM_002214 Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI Predict reactive species\nFull Name: integrin, beta 8\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: NM_002214\nGene Symbol: Integrin beta 8\nGene ID (NCBI): 3696\nRRID: AB_3672067\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P26012\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888771387561,"sku":"84558-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84558-1-rr","provider":"Iright","version":"1.0","type":"link"}