{"product_id":"proteintech-84564-4-rr","title":"Proteintech, 84564-4-RR, ER Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ER (84564-4-RR) by Proteintech is a Recombinant antibody targeting ER in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84564-4-RR targets ER in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells\nPositive IHC detected in: human ovary cancer tissue, human breast cancer tissue,  human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe estrogen receptor (ESR, ER) is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. ESR1, also known as ESR or NR3A1, belongs to the nuclear hormone receptor family and NR3 subfamily. It is a nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. ESR1 can activate the transcriptional activity of TFF1.[PMID: 11731608,10970861]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2234 Product name: Recombinant Human ER protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-116 aa of BC128573 Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ Predict reactive species\nFull Name: estrogen receptor 1\nCalculated Molecular Weight: 595 aa, 66 kDa\nObserved Molecular Weight: 66 kDa\nGenBank Accession Number: BC128573\nGene Symbol: ER\nGene ID (NCBI): 2099\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P03372\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888684060841,"sku":"84564-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84564-4-rr","provider":"Iright","version":"1.0","type":"link"}