{"product_id":"proteintech-84608-5-rr","title":"Proteintech, 84608-5-RR, EMR2\/CD312 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EMR2\/CD312 (84608-5-RR) by Proteintech is a Recombinant antibody targeting EMR2\/CD312 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84608-5-RR targets EMR2\/CD312 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, THP-1 cells,  L02 cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEMR2 (Epidermal Growth Factor-like module-containing Mucin-like Hormone Receptor 2), also known as ADGRE2, is a member of the adhesion-GPCR family that contains extracellular EGF-like domains.  EMR2 contains a total of five tandem EGF-like domains and expresses similar protein isoforms consisting of various numbers of EGF-like domains as a result of alternative RNA splicing (PMID: 10903844). EMR2 is restricted to myeloid cells including monocytes, macrophages, dendritic cells and granulocytes28 and its expression is highly regulated during monocyte\/macrophage differentiation (PMID: 31969668).The ligation of EMR2 could increase neutrophil adhesion, migration and anti-microbial mediator production and could enhance the systemic inflammation (PMID: 27905560).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2479 Product name: Recombinant Human EMR2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-260 aa of NM_013447.3 Sequence: QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCE Predict reactive species\nFull Name: egf-like module containing, mucin-like, hormone receptor-like 2\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 75~90 kDa\nGenBank Accession Number: NM_013447.3\nGene Symbol: EMR2\nGene ID (NCBI): 30817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UHX3-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888739668137,"sku":"84608-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84608-5-rr","provider":"Iright","version":"1.0","type":"link"}