{"product_id":"proteintech-84619-5-rr","title":"Proteintech, 84619-5-RR, FADD Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FADD (84619-5-RR) by Proteintech is a Recombinant antibody targeting FADD in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84619-5-RR targets FADD in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  Jurkat cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: A431 cells, HT-1080 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFas-Associated protein with Death Domain (FADD), also called MORT1 or GIG3, is encoded by the FADD gene. FADD is an adaptor protein that bridges members of the tumor necrosis factor receptor superfamily, such as the Fas-receptor, to procaspases 8 and 10 to form the death-inducing signaling complex (DISC) during apoptosis. As well as its most well known role in apoptosis, FADD has also been seen to play a role in other processes including proliferation, cell cycle regulation and development. FADD has a calculated molecular mass of 23 kDa and always can be detected as 23-30 kDa (PMID: 15390286, 22864571, 17977957)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6701 Product name: Recombinant human FADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000334 Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Predict reactive species\nFull Name: Fas (TNFRSF6)-associated via death domain\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC000334\nGene Symbol: FADD\nGene ID (NCBI): 8772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888532803753,"sku":"84619-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84619-5-rr","provider":"Iright","version":"1.0","type":"link"}