{"product_id":"proteintech-84625-3-rr","title":"Proteintech, 84625-3-RR, BLIMP1\/PRDM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BLIMP1\/PRDM1 (84625-3-RR) by Proteintech is a Recombinant antibody targeting BLIMP1\/PRDM1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84625-3-RR targets BLIMP1\/PRDM1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cell,  A431 cells\nPositive IF\/ICC detected in: A549 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBLIMP1(B lymphocyte-induced maturation protein 1), also known as PRDM1(PR domain zinc finger protein 1), is an evolutionarily conserved transcriptional regulator originally described as a repressor of gene transcription(PMID: 35154079). BLIMP1\/PRDM1 is widely expressed in multiple cell types including B lymphocytes, T lymphocytes, mammary luminal progenitor cells and skin epithelial cells. BLIMP1\/PRDM1 is a master regulator of terminal B cell differentiation and may also function as a tumor suppressor in the pathogenesis of DLBCL, where it is frequently inactivated by mutations and deletions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2625 Product name: Recombinant Human PRDM1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 45-230 aa of NM_001198.3 Sequence: DMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQSSLKQ Predict reactive species\nFull Name: PR domain containing 1, with ZNF domain\nCalculated Molecular Weight: 92 kDa\nObserved Molecular Weight: 96-110 kDa\nGenBank Accession Number: NM_001198.3\nGene Symbol: PRDM1\nGene ID (NCBI): 639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O75626-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888711848105,"sku":"84625-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84625-3-rr","provider":"Iright","version":"1.0","type":"link"}