{"product_id":"proteintech-84700-1-rr","title":"Proteintech, 84700-1-RR, NOX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NOX1 (84700-1-RR) by Proteintech is a Recombinant antibody targeting NOX1 in WB, ELISA applications with reactivity to human, mouse samples\n84700-1-RR targets NOX1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, COLO 320 cells,  Caco-2 cells,  mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNNOX1(NADPH oxidase 1) is also named as MOX1, NOH1 and belongs to the reactive oxygen species (ROS)-generating NADPH oxidase family. It plays a role in host defense, cell growth and differentiation, cell migration, and malignant transformation(PMID:20351171). It also can mediate oncogenic Ras-induced upregulation of VEGF and angiogenesis by activating Sp1 through Ras-ERK-dependent phosphorylation of Sp1(PMID:18454179). It has 3 isoforms produced by alternative splicing with the molecular weight of 65 kDa, 22 kDa and 59 kDa. The full length protein has two glycosylation sites. It always can be detected two bands of 63 kDa and 55 kDa in cells by western blot or another lower band of 45 kDa which is not likely due to alternative translation or splice variation, but as adjustment for the signal peptide and tag removal(PMID:17560373) or unspecifc(PMID:17460729).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12187 Product name: Recombinant human NOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 292-560 aa of BC075014 Sequence: QQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN Predict reactive species\nFull Name: NADPH oxidase 1\nCalculated Molecular Weight: 564 aa, 65 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC075014\nGene Symbol: NOX1\nGene ID (NCBI): 27035\nRRID: AB_3672116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y5S8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888791539881,"sku":"84700-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84700-1-rr","provider":"Iright","version":"1.0","type":"link"}