{"product_id":"proteintech-84705-4-rr","title":"Proteintech, 84705-4-RR, CYP51A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CYP51A1 (84705-4-RR) by Proteintech is a Recombinant antibody targeting CYP51A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84705-4-RR targets CYP51A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  HuH-7 cells,  HEK-293 cells,  RAW 264.7 cells,  mouse testis tissue,  rat liver tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HuH-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLanosterol 14-alpha demethylase (cytochrome P450(51), CYP51A1) belongs to the evolutionarily conserved family of cytochrome P450 and catalyzes one of the key steps in cholesterol biosynthesis. CYP51A1 protein is targeted for degradation when exposed to nitric oxide generated under inflammatory conditions by NOS2 or released from NO donor compounds (PMID: 28830911). CYP51A1 is a prognostic marker in certain cancers, including Cervical squamous cell carcinoma, Head and neck squamous cell carcinoma, Kidney chromophobe, and Kidney renal clear cell carcinoma (PMID: 24711211).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4235 Product name: Recombinant human CYP51A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 146-509 aa of BC032322 Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK Predict reactive species\nFull Name: cytochrome P450, family 51, subfamily A, polypeptide 1\nCalculated Molecular Weight: 509 aa, 57 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC032322\nGene Symbol: CYP51A1\nGene ID (NCBI): 1595\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q16850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888732852393,"sku":"84705-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84705-4-rr","provider":"Iright","version":"1.0","type":"link"}