{"product_id":"proteintech-84738-2-rr","title":"Proteintech, 84738-2-RR, EVI5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EVI5 (84738-2-RR) by Proteintech is a Recombinant antibody targeting EVI5 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84738-2-RR targets EVI5 in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEVI5 functions as a regulator of cell cycle progression by stabilizing the FBXO5 protein and promoting cyclin-A accumulation during interphase. It may play a role in cytokinesis (PMID: 16439210).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26739 Product name: Recombinant human EVI5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC156793 Sequence: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSP Predict reactive species\nFull Name: ecotropic viral integration site 5\nCalculated Molecular Weight: 810 aa, 93 kDa\nGenBank Accession Number: BC156793\nGene Symbol: EVI5\nGene ID (NCBI): 7813\nRRID: AB_3672122\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O60447\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888742682793,"sku":"84738-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84738-2-rr","provider":"Iright","version":"1.0","type":"link"}