{"product_id":"proteintech-84744-1-rr","title":"Proteintech, 84744-1-RR, TTK Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TTK (84744-1-RR) by Proteintech is a Recombinant antibody targeting TTK in WB, ELISA applications with reactivity to human, mouse, rat samples\n84744-1-RR targets TTK in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  DU 145 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and\/or spindle pole bodies\/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag20556 Product name: Recombinant human TTK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 536-789 aa of BC000633 Sequence: SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP Predict reactive species\nFull Name: TTK protein kinase\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: BC000633\nGene Symbol: TTK\nGene ID (NCBI): 7272\nRRID: AB_3672129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P33981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888837841065,"sku":"84744-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84744-1-rr","provider":"Iright","version":"1.0","type":"link"}