{"product_id":"proteintech-84762-3-rr","title":"Proteintech, 84762-3-RR, CACNB3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CACNB3 (84762-3-RR) by Proteintech is a Recombinant antibody targeting CACNB3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n84762-3-RR targets CACNB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, mouse brain tissue,  HeLa cells,  SH-SY5Y cells,  SKOV-3 cells,  SW480 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35651 Product name: Recombinant human CACNB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-484 aa of NM_000725.3 Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY Predict reactive species\nFull Name: calcium channel, voltage-dependent, beta 3 subunit\nCalculated Molecular Weight: 55kDa，484aa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: NM_000725.3\nGene Symbol: CACNB3\nGene ID (NCBI): 784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P54284\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888715092137,"sku":"84762-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84762-3-rr","provider":"Iright","version":"1.0","type":"link"}