{"product_id":"proteintech-84801-13-rr","title":"Proteintech, 84801-13-RR, CD9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD9 (84801-13-RR) by Proteintech is a Recombinant antibody targeting CD9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84801-13-RR targets CD9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, J774A.1 cells,  mouse spleen tissue\nPositive IHC detected in: mouse spleen tissue, human prostate cancer tissue,  mouse kidney tissue,  rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD9, also known as Tspan-29, p24, or MIC3, is a member of the tetraspanin superfamily (PMID: 1879540). It is expressed on a large variety of hematopoietic and non-hematopoietic cells, such as stromal cells, megakaryocytes, platelets, B and T lymphocytes, dendritic cells, endothelial cells, mast cells, eosinophils, and basophils (PMID: 30356731). CD9 interacts with the integrin family and other membrane proteins, and is involved in cell adhesion, cell motility, and tumor metastasis (PMID: 8478605; 21428940; 25805926). Expression of CD9 enhances membrane fusion between muscle cells and supports myotube maintenance (PMID:10459022). On oocytes, CD9 is hypothesized to play a role in the fertilization of mammals (PMID: 25536312).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1397 Product name: Recombinant Mouse CD9 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 110-193 aa of NM_007657.3 Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI Predict reactive species\nFull Name: CD9 antigen\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: NM_007657.3\nGene Symbol: Cd9\nGene ID (NCBI): 12527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40240\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888723906729,"sku":"84801-13-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84801-13-rr","provider":"Iright","version":"1.0","type":"link"}