{"product_id":"proteintech-84880-1-rr","title":"Proteintech, 84880-1-RR, NDUFS2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NDUFS2 (84880-1-RR) by Proteintech is a Recombinant antibody targeting NDUFS2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84880-1-RR targets NDUFS2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  HeLa cells,  mouse heart tissue,  mouse liver tissue,  mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human stomach cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial Complex I, responsible for the oxidation of NADH, is suspected to be an integral component of the O2-sensing pathway. NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2), a key subunit of complex I in the mitochondrial electron transport chain (ETC), is essential for acute oxygen-sensing and hypoxic pulmonary vasoconstriction (PMID: 30922174). Functions of NDUFS2 are associated with growth, cell-membrane integrity, ROS generation, apoptosis, necrosis, Complex I respiration, and synthesis of ATP (PMID: 33744462).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28008 Product name: Recombinant human NDUFS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-464 aa of BC000170 Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC000170\nGene Symbol: NDUFS2\nGene ID (NCBI): 4720\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75306\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789311657,"sku":"84880-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84880-1-rr","provider":"Iright","version":"1.0","type":"link"}