{"product_id":"proteintech-84922-6-rr","title":"Proteintech, 84922-6-RR, JUNB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe JUNB (84922-6-RR) by Proteintech is a Recombinant antibody targeting JUNB in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples\n84922-6-RR targets JUNB in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, A431 cells\nPositive FC (Intra) detected in: HeLa cells\nPositive ChIP-qPCR detected in: β-NGF(starved overnight) (50 ng\/ml, 2 h) PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0\/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1\/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0752 Product name: Recombinant human JUNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004250 Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA Predict reactive species\nFull Name: jun B proto-oncogene\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 38 kDa, 42 kDa\nGenBank Accession Number: BC004250\nGene Symbol: JUNB\nGene ID (NCBI): 3726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P17275\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888773484713,"sku":"84922-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84922-6-rr","provider":"Iright","version":"1.0","type":"link"}