{"product_id":"proteintech-84934-1-rr","title":"Proteintech, 84934-1-RR, PSMC3IP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PSMC3IP (84934-1-RR) by Proteintech is a Recombinant antibody targeting PSMC3IP in WB, IHC, ELISA applications with reactivity to human, mouse samples\n84934-1-RR targets PSMC3IP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  mouse testis tissue,  HEK-293 cells,  MCF-7 cells,  K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMC3IP, also called HOP2, encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP\/MND1 complex, which interacts with PSMC3\/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1883 Product name: Recombinant human PSMC3IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC008792 Sequence: MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP Predict reactive species\nFull Name: PSMC3 interacting protein\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 24-29 kDa\nGenBank Accession Number: BC008792\nGene Symbol: PSMC3IP\nGene ID (NCBI): 29893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P2W1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888811364521,"sku":"84934-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84934-1-rr","provider":"Iright","version":"1.0","type":"link"}