{"product_id":"proteintech-84968-4-rr","title":"Proteintech, 84968-4-RR, RBM25 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RBM25 (84968-4-RR) by Proteintech is a Recombinant antibody targeting RBM25 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n84968-4-RR targets RBM25 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  HeLa cells，Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNA-binding protein 25 (RBM25), also named as Protein S164 or RNPC7, is a 843 amino acid protein, which contains one RRM domain and one PWI domain. RBM25 localizes in the nucleus and cytoplasm. RBM25 acts as a regulator of alternative pre-mRNA splicing and is involved in apoptotic cell death through the regulation of the apoptotic factor BCL2L1 isoform expression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18244 Product name: Recombinant human RBM25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 605-839 aa of BC113389 Sequence: QKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPEEHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIGLVK Predict reactive species\nFull Name: RNA binding motif protein 25\nCalculated Molecular Weight: 843 aa, 100 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC113389\nGene Symbol: RBM25\nGene ID (NCBI): 58517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P49756\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888813723817,"sku":"84968-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-84968-4-rr","provider":"Iright","version":"1.0","type":"link"}