{"product_id":"proteintech-85020-4-rr","title":"Proteintech, 85020-4-RR, eNOS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe eNOS (85020-4-RR) by Proteintech is a Recombinant antibody targeting eNOS in WB, ELISA applications with reactivity to human, mouse samples\n85020-4-RR targets eNOS in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: bEnd.3 cells, HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25712 Product name: Recombinant human NOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP Predict reactive species\nFull Name: nitric oxide synthase 3 (endothelial cell)\nObserved Molecular Weight: 140 kDa\nGene Symbol: eNOS\nGene ID (NCBI): 4846\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29474\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612593833,"sku":"85020-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85020-4-rr","provider":"Iright","version":"1.0","type":"link"}