{"product_id":"proteintech-85022-3-rr","title":"Proteintech, 85022-3-RR, DOCK11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DOCK11 (85022-3-RR) by Proteintech is a Recombinant antibody targeting DOCK11 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n85022-3-RR targets DOCK11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  RAW 264.7 cells,  HEK-293 cells,  Jurkat cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDOCK11(also known as Zizimin2) is a member of CDM (Ced-5, DOCK180, and Myoblast City) family guanine nucleotide exchange factor mainly expressed in immune cells.  As a guanine nucleotide exchange factor, DOCK11 activated the rho family GTPase cell division cycle 42 (CDC42), resulting in cytoskeletal reorganization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35831 Product name: Recombinant human DOCK11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-400 aa of NM_144658 Sequence: HYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINL Predict reactive species\nFull Name: dedicator of cytokinesis 11\nCalculated Molecular Weight: 238 kDa\nObserved Molecular Weight: 238 kDa\nGenBank Accession Number: NM_144658\nGene Symbol: DOCK11\nGene ID (NCBI): 139818\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5JSL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888611119273,"sku":"85022-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85022-3-rr","provider":"Iright","version":"1.0","type":"link"}