{"product_id":"proteintech-85023-2-rr","title":"Proteintech, 85023-2-RR, ZNF517 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZNF517 (85023-2-RR) by Proteintech is a Recombinant antibody targeting ZNF517 in WB, ELISA applications with reactivity to human, mouse samples\n85023-2-RR targets ZNF517 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ZNF family genes are an ancient group of mammalian paralogous homologs, and ZNF517 has been continuously lost during evolution, and although ZNF517 may be involved in transcriptional regulation, its exact function is unknown. A partial deletion and down-regulation of ZNF517 gene expression in cutaneous malignant melanoma (CMM) has been noted.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag37110 Product name: Recombinant human ZNF517 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 280-390 aa of BC126161 Sequence: QKFHTGEKPFACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLH Predict reactive species\nFull Name: zinc finger protein 517\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC126161\nGene Symbol: ZNF517\nGene ID (NCBI): 340385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6ZMY9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888845082793,"sku":"85023-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85023-2-rr","provider":"Iright","version":"1.0","type":"link"}