{"product_id":"proteintech-85026-4-rr","title":"Proteintech, 85026-4-RR, RSPH9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RSPH9 (85026-4-RR) by Proteintech is a Recombinant antibody targeting RSPH9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85026-4-RR targets RSPH9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue,  human testis cells\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSPH9 (Radial Spoke Head 9 Homolog) is a protein involved in the structure and function of cilia and flagella. Cilia and flagella are hair-like structures that extend from the surface of many eukaryotic cells and play critical roles in cell motility, sensory perception, and signaling. The RSPH9 protein is a component of the radial spoke, a structure within the axoneme (the core of cilia and flagella) that is essential for the regulation of ciliary and flagellar movement.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19745 Product name: Recombinant human RSPH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC029519 Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML Predict reactive species\nFull Name: radial spoke head 9 homolog (Chlamydomonas)\nCalculated Molecular Weight: 276 aa, 31 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC029519\nGene Symbol: RSPH9\nGene ID (NCBI): 221421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H1X1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888661876905,"sku":"85026-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85026-4-rr","provider":"Iright","version":"1.0","type":"link"}