{"product_id":"proteintech-85038-7-rr","title":"Proteintech, 85038-7-RR, NME1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NME1 (85038-7-RR) by Proteintech is a Recombinant antibody targeting NME1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n85038-7-RR targets NME1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  HepG2 cells,  A549 cells,  MCF-7 cells,  Jurkat cells,  C6 cells\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNME1 is also named as NDPKA(Nucleoside diphosphate kinase A), NM23(Metastasis inhibition factor nm23),GAAD(Granzyme A-activated DNase) and belongs to the NDK family.It is a major role in the synthesis of nucleoside triphosphates other than ATP and required for neural development including neural patterning and cell fate determination. It has 3 isoforms produced by alternative splicing. Refer to the epitope and protein detection, this antibody specifically recognizes NME1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1548 Product name: Recombinant human NME1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC018994 Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE Predict reactive species\nFull Name: non-metastatic cells 1, protein (NM23A) expressed in\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC018994\nGene Symbol: NME1\nGene ID (NCBI): 4830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888790950057,"sku":"85038-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85038-7-rr","provider":"Iright","version":"1.0","type":"link"}