{"product_id":"proteintech-85067-5-rr","title":"Proteintech, 85067-5-RR, Arrestin C Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Arrestin C (85067-5-RR) by Proteintech is a Recombinant antibody targeting Arrestin C in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n85067-5-RR targets Arrestin C in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, rat eye tissues\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nArrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1580 Product name: Recombinant human ARR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012096 Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS Predict reactive species\nFull Name: arrestin 3, retinal (X-arrestin)\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC012096\nGene Symbol: Arrestin C\nGene ID (NCBI): 407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P36575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888366768297,"sku":"85067-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85067-5-rr","provider":"Iright","version":"1.0","type":"link"}