{"product_id":"proteintech-85072-5-rr","title":"Proteintech, 85072-5-RR, IRF7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IRF7 (85072-5-RR) by Proteintech is a Recombinant antibody targeting IRF7 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n85072-5-RR targets IRF7 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN alpha treated Jurkat cells\nPositive IF\/ICC detected in: Caco-2 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF-7 (IFN regulatory factor 7) is a member of the IFN regulatory transcription factor (IRF) family. IRF-7 has been shown to play a role in the transcriptional activation of virus-inducible cellular proteins, including IFN beta chain proteins. Inducible expression of IRF-7 is largely restricted to lymphoid tissue. Four transcript variants encoding distinct isoforms (A,B,C and D) have been identified for this (PMID:9786932).The active IRF7A exists as a dimer form ~80 kDa(PMID:11073981). The MW 67-70 kDa has been reported in some papers (PMID:9786932; 22951831).Various posttranslational modifications of IRF7 including phosphorylation, ubiquitination, sumoylation and acetylation are identified (PMID:22951831).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18059 Product name: Recombinant human IRF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-516 aa of BC136555 Sequence: PGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA Predict reactive species\nFull Name: IRF 7\nCalculated Molecular Weight: 516 aa, 56 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC136555\nGene Symbol: IRF7\nGene ID (NCBI): 3665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92985\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888772599977,"sku":"85072-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85072-5-rr","provider":"Iright","version":"1.0","type":"link"}