{"product_id":"proteintech-85075-1-rr","title":"Proteintech, 85075-1-RR, PTK7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTK7 (85075-1-RR) by Proteintech is a Recombinant antibody targeting PTK7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85075-1-RR targets PTK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, C2C12 cells,  PC-12 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein tyrosine kinase 7 (PTK7), also known as colon carcinoma kinase 4 (CCK4), is an atypical receptor tyrosine kinase that consists of an extracellular domain with seven immunoglobulin-like domains, a transmembrane domain, and a catalytically defective tyrosine kinase domain (PMID: 29867084). It is implicated in planar cell polarity and the Wnt canonical and non-canonical pathways (PMID: 24618420). Overexpression of PTK7 has been reported in a variety of tumors, such as cervical cancer, colon cancer, lung adenocarcinoma, acute myelogenous leukemia, and gastric cancer (PMID: 30944666).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag12026 Product name: Recombinant human PTK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 724-1070 aa of BC071557 Sequence: FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP Predict reactive species\nFull Name: PTK7 protein tyrosine kinase 7\nCalculated Molecular Weight: 1070 aa, 118 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC071557\nGene Symbol: PTK7\nGene ID (NCBI): 5754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13308\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888659615913,"sku":"85075-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85075-1-rr","provider":"Iright","version":"1.0","type":"link"}