{"product_id":"proteintech-85100-1-rr","title":"Proteintech, 85100-1-RR, GDF-15 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GDF-15 (85100-1-RR) by Proteintech is a Recombinant antibody targeting GDF-15 in WB, IHC, ELISA applications with reactivity to human samples\n85100-1-RR targets GDF-15 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, A549 cells,  HepG2 cells,  human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nassociated with hypoxia, inﬂammation and oxidative stress, it is also released from endothelial cells after stimulation with pro-inflammatory cytokines. GDF15 has been suggested as a target and biomarker for cardiovascular disease as it plays a cardioprotective role in the adult heart. GDF15 is highly expressed in the placenta. GDF15 is known to be involved in human embryo development and necessary for the maintenance of pregnancy. GDF15 is also produced by adipocytes in response to oxidative stress, a well-known factor associated with preeclampsia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26790 Product name: Recombinant human GDF15 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 30-308 aa of BC008962 Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI Predict reactive species\nFull Name: growth differentiation factor 15\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC008962\nGene Symbol: GDF15\nGene ID (NCBI): 9518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q99988\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888638349481,"sku":"85100-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85100-1-rr","provider":"Iright","version":"1.0","type":"link"}