{"product_id":"proteintech-85144-5-rr","title":"Proteintech, 85144-5-RR, CXCR2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCR2 (85144-5-RR) by Proteintech is a Recombinant antibody targeting CXCR2 in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n85144-5-RR targets CXCR2 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue\nPositive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCR2, also named as Cmkar2, Gpcr16, Il8rb or CD182, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity.  CXCR2 also binds with high affinity to CXCL3, GRO\/MGSA and NAP-2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species\nFull Name: interleukin 8 receptor, beta\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_009909.3\nGene Symbol: Cxcr2\nGene ID (NCBI): 12765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35343\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731672745,"sku":"85144-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85144-5-rr","provider":"Iright","version":"1.0","type":"link"}