{"product_id":"proteintech-85150-4-rr","title":"Proteintech, 85150-4-RR, TORC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TORC2 (85150-4-RR) by Proteintech is a Recombinant antibody targeting TORC2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n85150-4-RR targets TORC2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  Jurkat cells,  Raji cells,  A-673 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRTC2, also named as TORC2, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. It acts as a coactivator, in the SIK\/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. CRTC2 enhances the interaction of CREB1 with TAF4. Ir regulates gluconeogenesis as a component of the LKB1\/AMPK\/TORC2 signaling pathway. CRTC2 regulates the expression of specific genes such as the steroidogenic gene, StAR. TORC2 was recently shown to be an important regulator of gluconeogenesis in the livers of mammals. It is one of the other key regulators of CRE-dependent MIE gene expression in NT2 cells. This regulation is linked to VIP-induced TORC2 dephosphorylation and translocation to the nucleus. (PMID: 19369332, 20504934 ) .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3167 Product name: Recombinant human CRTC2,TORC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-693 aa of BC053562 Sequence: APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ Predict reactive species\nFull Name: CREB regulated transcription coactivator 2\nCalculated Molecular Weight: 693 aa, 73 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC053562\nGene Symbol: TORC2\nGene ID (NCBI): 200186\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q53ET0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888834465961,"sku":"85150-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85150-4-rr","provider":"Iright","version":"1.0","type":"link"}