{"product_id":"proteintech-85151-4-rr","title":"Proteintech, 85151-4-RR, INPP4B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe INPP4B (85151-4-RR) by Proteintech is a Recombinant antibody targeting INPP4B in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n85151-4-RR targets INPP4B in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, A549 cells,  HeLa cells,  MCF-7 cells\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: K562\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8676 Product name: Recombinant human INPP4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC005273 Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD Predict reactive species\nFull Name: inositol polyphosphate-4-phosphatase, type II, 105kDa\nCalculated Molecular Weight: 53 aa, 6 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC005273\nGene Symbol: INPP4B\nGene ID (NCBI): 8821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15327\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888769913001,"sku":"85151-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85151-4-rr","provider":"Iright","version":"1.0","type":"link"}