{"product_id":"proteintech-85182-1-rr","title":"Proteintech, 85182-1-RR, Glycophorin A\/CD235a Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Glycophorin A\/CD235a (85182-1-RR) by Proteintech is a Recombinant antibody targeting Glycophorin A\/CD235a in WB, IHC, ELISA applications with reactivity to human samples\n85182-1-RR targets Glycophorin A\/CD235a in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:10000-1:40000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid\/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species\nFull Name: glycophorin A (MNS blood group)\nCalculated Molecular Weight: 150 aa, 16 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC005319\nGene Symbol: Glycophorin A\nGene ID (NCBI): 2993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02724\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888756412585,"sku":"85182-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85182-1-rr","provider":"Iright","version":"1.0","type":"link"}