{"product_id":"proteintech-85210-5-rr","title":"Proteintech, 85210-5-RR, KCTD5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KCTD5 (85210-5-RR) by Proteintech is a Recombinant antibody targeting KCTD5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n85210-5-RR targets KCTD5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SW480 cells,  A172 cells,  RAW 264.7 cells,  PC-12 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7915 Product name: Recombinant human KCTD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC007314 Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM Predict reactive species\nFull Name: potassium channel tetramerisation domain containing 5\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC007314\nGene Symbol: KCTD5\nGene ID (NCBI): 54442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NXV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888773943465,"sku":"85210-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85210-5-rr","provider":"Iright","version":"1.0","type":"link"}