{"product_id":"proteintech-85254-3-rr","title":"Proteintech, 85254-3-RR, IRF1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IRF1 (85254-3-RR) by Proteintech is a Recombinant antibody targeting IRF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n85254-3-RR targets IRF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HL-60 cells,  Jurkat cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: IFN gamma treated HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF1, also named as IFN regulatory factor 1, is a 325 amino acid protein, which belongs to the IRF family. IRF1 as a transcriptional regulator which displays a remarkable functional diversity in the regulation of cellular responses. The calculated molecular weight of IRF1 is 37 kDa, but the modified IRF1 protein is about 45-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1879 Product name: Recombinant human IRF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC009483 Sequence: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP Predict reactive species\nFull Name: IRF 1\nCalculated Molecular Weight: 325 aa, 37 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC009483\nGene Symbol: IRF1\nGene ID (NCBI): 3659\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10914\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888772337833,"sku":"85254-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85254-3-rr","provider":"Iright","version":"1.0","type":"link"}