{"product_id":"proteintech-85390-2-rr","title":"Proteintech, 85390-2-RR, FCER1G Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FCER1G (85390-2-RR) by Proteintech is a Recombinant antibody targeting FCER1G in WB, ELISA applications with reactivity to human, mouse, pig samples\n85390-2-RR targets FCER1G in WB, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HL-60 cells,  RAW 264.7 cells,  pig spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4442 Product name: Recombinant human FCER1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC033872 Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Predict reactive species\nFull Name: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide\nCalculated Molecular Weight: 87 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC033872\nGene Symbol: FcRγ\nGene ID (NCBI): 2207\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30273\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888745435305,"sku":"85390-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85390-2-rr","provider":"Iright","version":"1.0","type":"link"}