{"product_id":"proteintech-85422-1-rr","title":"Proteintech, 85422-1-RR, HNRNPM Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HNRNPM (85422-1-RR) by Proteintech is a Recombinant antibody targeting HNRNPM in WB, IF\/ICC, ELISA applications with reactivity to human samples\n85422-1-RR targets HNRNPM in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  COLO 320 cells,  MCF-7 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists three isoforms MW range form 73 kDa and 77 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein M\nCalculated Molecular Weight: 78 kDa\nObserved Molecular Weight: 73-77 kDa\nGenBank Accession Number: BC000138\nGene Symbol: HNRNPM\nGene ID (NCBI): 4670\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P52272\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888762704041,"sku":"85422-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85422-1-rr","provider":"Iright","version":"1.0","type":"link"}