{"product_id":"proteintech-85606-5-rr","title":"Proteintech, 85606-5-RR, CXCL5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCL5 (85606-5-RR) by Proteintech is a Recombinant antibody targeting CXCL5 in WB, ELISA applications with reactivity to human samples\n85606-5-RR targets CXCL5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TNF alpha, PMA and BSA treated A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2939 Product name: Recombinant Human CXCL5 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 37-114 aa of NM_002994.4 Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 5\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: NM_002994.4\nGene Symbol: CXCL5\nGene ID (NCBI): 6374\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888609054889,"sku":"85606-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85606-5-rr","provider":"Iright","version":"1.0","type":"link"}