{"product_id":"proteintech-85638-4-rr","title":"Proteintech, 85638-4-RR, FARP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FARP1 (85638-4-RR) by Proteintech is a Recombinant antibody targeting FARP1 in WB, ELISA applications with reactivity to human samples\n85638-4-RR targets FARP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A549 cells,  HeLa cells,  A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFARP1 is a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21225 Product name: Recombinant human FARP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 347-539 aa of BC071592 Sequence: VLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTD Predict reactive species\nFull Name: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)\nCalculated Molecular Weight: 1076 aa, 122 kDa\nObserved Molecular Weight: 122-130 kDa\nGenBank Accession Number: BC071592\nGene Symbol: FARP1\nGene ID (NCBI): 10160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y4F1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888744845481,"sku":"85638-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85638-4-rr","provider":"Iright","version":"1.0","type":"link"}