{"product_id":"proteintech-85657-5-rr","title":"Proteintech, 85657-5-RR, Mammaglobin A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Mammaglobin A (85657-5-RR) by Proteintech is a Recombinant antibody targeting Mammaglobin A in WB, ELISA applications with reactivity to human samples\n85657-5-RR targets Mammaglobin A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2887 Product name: Recombinant Human Mammaglobin A protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-93 aa of NM_002411.3 Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species\nFull Name: secretoglobin, family 2A, member 2\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: NM_002411.3\nGene Symbol: Mammaglobin A\nGene ID (NCBI): 4250\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13296-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888648671401,"sku":"85657-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85657-5-rr","provider":"Iright","version":"1.0","type":"link"}