{"product_id":"proteintech-85754-4-rr","title":"Proteintech, 85754-4-RR, IL-12A\/IL-12 p35 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IL-12A\/IL-12 p35 (85754-4-RR) by Proteintech is a Recombinant antibody targeting IL-12A\/IL-12 p35 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n85754-4-RR targets IL-12A\/IL-12 p35 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\nPositive IF\/ICC detected in: IFN gamma and LPS treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-12A (Interleukin-12A) is a subunit of the cytokine IL-12, which is also known as IL-12 p35. IL-12 is a heterodimeric cytokine composed of two subunits: IL-12A (p35) and IL-12B (p40). This cytokine plays a crucial role in the immune response, particularly in the activation and differentiation of T cells and natural killer (NK) cells. This antibody recognizes IL-12A and IL-12 P70, which consists of IL-12A and B, but does not recognize IL-12B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3341 Product name: Recombinant Human IL12A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-219 aa of BC104982 Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS Predict reactive species\nFull Name: interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC104982\nGene Symbol: IL-12A\nGene ID (NCBI): 3592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29459\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888767652009,"sku":"85754-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85754-4-rr","provider":"Iright","version":"1.0","type":"link"}