{"product_id":"proteintech-85789-3-rr","title":"Proteintech, 85789-3-RR, DDX18 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DDX18 (85789-3-RR) by Proteintech is a Recombinant antibody targeting DDX18 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n85789-3-RR targets DDX18 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  K-562 cells,  Jurkat cells,  MCF-7 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27457 Product name: Recombinant human DDX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-165 aa of BC001238 Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC001238\nGene Symbol: DDX18\nGene ID (NCBI): 8886\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NVP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888734523561,"sku":"85789-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85789-3-rr","provider":"Iright","version":"1.0","type":"link"}