{"product_id":"proteintech-85859-5-rr","title":"Proteintech, 85859-5-RR, HIC5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HIC5 (85859-5-RR) by Proteintech is a Recombinant antibody targeting HIC5 in WB, ELISA applications with reactivity to human, rat samples\n85859-5-RR targets HIC5 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat colon tissue,  SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIC5 (Hydrogen Peroxide-Inducible Clone 5), also known as TGFB1I1, ARA55, or TSC-5. It was first identified in 1994 as a gene induced by transforming growth factor-β (TGF-β) or hydrogen peroxide (PMID: 36222304). HIC5 is a member of the Paxillin protein family and functions as a molecular adapter, delivering signals when the cellular adhesion environment changes. Given its role in cancer and fibrotic diseases, HIC5 is a potential therapeutic target. For example, targeting HIC5 or the GR tau2 region could modulate the set of genes regulated by GR, providing opportunities for intervention (PMID: 24591583).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0868 Product name: Recombinant human TGFB1I1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC001830 Sequence: MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAW Predict reactive species\nFull Name: transforming growth factor beta 1 induced transcript 1\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48-50 kDa\nGenBank Accession Number: BC001830\nGene Symbol: HIC5\nGene ID (NCBI): 7041\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43294\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888761589929,"sku":"85859-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85859-5-rr","provider":"Iright","version":"1.0","type":"link"}