{"product_id":"proteintech-85895-3-rr","title":"Proteintech, 85895-3-RR, Cyclin B1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cyclin B1 (85895-3-RR) by Proteintech is a Recombinant antibody targeting Cyclin B1 in WB, ELISA applications with reactivity to human samples\n85895-3-RR targets Cyclin B1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2\/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to  phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species\nFull Name: cyclin B1\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC006510\nGene Symbol: Cyclin B1\nGene ID (NCBI): 891\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P14635\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731869353,"sku":"85895-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85895-3-rr","provider":"Iright","version":"1.0","type":"link"}