{"product_id":"proteintech-85901-1-rr","title":"Proteintech, 85901-1-RR, EPOR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPOR (85901-1-RR) by Proteintech is a Recombinant antibody targeting EPOR in WB, ELISA applications with reactivity to mouse samples\n85901-1-RR targets EPOR in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse serum\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nErythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2\/STAT5, PI3K\/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351). The calculated molecular weight of EPOR is 55 kDa. EPOR undergoes posttranslational modification and the apparent molecular weight of 66-78 kDa has been reported (PMID: 8943308; 12088257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2711 Product name: Recombinant Mouse Epor protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-249 aa of NM_010149.3 Sequence: APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP Predict reactive species\nFull Name: erythropoietin receptor\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: NM_010149.3\nGene Symbol: Epor\nGene ID (NCBI): 13857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P14753-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612921513,"sku":"85901-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85901-1-rr","provider":"Iright","version":"1.0","type":"link"}