{"product_id":"proteintech-85923-1-rr","title":"Proteintech, 85923-1-RR, Neuroserpin Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Neuroserpin (85923-1-RR) by Proteintech is a Recombinant antibody targeting Neuroserpin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples\n85923-1-RR targets Neuroserpin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  pig brain tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2819 Product name: Recombinant Human Neuroserpin protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 17-410 aa of NM_005025.4 Sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Predict reactive species\nFull Name: serpin peptidase inhibitor, clade I (neuroserpin), member 1\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: NM_005025.4\nGene Symbol: Neuroserpin\nGene ID (NCBI): 5274\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789934249,"sku":"85923-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85923-1-rr","provider":"Iright","version":"1.0","type":"link"}